Medical Dialogues
  • Dermatology
Login Register
This site is intended for healthcare professionals only
Login Register
  • MD Brand Connect
  • Vaccine Hub
  • MDTV
    • Breaking News
    • Medical News Today
    • Health News Today
    • Latest
    • Journal Club
    • Medico Legal Update
    • Latest Webinars
    • MD Shorts
    • Health Dialogues
  • Fact Check
  • Health Dialogues
Medical Dialogues
  • Medical News & Guidelines
      • Anesthesiology
      • Cardiology and CTVS
      • Critical Care
      • Dentistry
      • Dermatology
      • Diabetes and Endocrinology
      • ENT
      • Gastroenterology
      • Medicine
      • Nephrology
      • Neurology
      • Obstretics-Gynaecology
      • Oncology
      • Ophthalmology
      • Orthopaedics
      • Pediatrics-Neonatology
      • Psychiatry
      • Pulmonology
      • Radiology
      • Surgery
      • Urology
      • Laboratory Medicine
      • Diet
      • Nursing
      • Paramedical
      • Physiotherapy
  • Health news
      • Doctor News
      • Government Policies
      • Hospital & Diagnostics
      • International Health News
      • Medical Organization News
      • Medico Legal News
      • NBE News
      • NMC News
  • Fact Check
      • Bone Health Fact Check
      • Brain Health Fact Check
      • Cancer Related Fact Check
      • Child Care Fact Check
      • Dental and oral health fact check
      • Diabetes and metabolic health fact check
      • Diet and Nutrition Fact Check
      • Eye and ENT Care Fact Check
      • Fitness fact check
      • Gut health fact check
      • Heart health fact check
      • Kidney health fact check
      • Medical education fact check
      • Men's health fact check
      • Respiratory fact check
      • Skin and hair care fact check
      • Vaccine and Immunization fact check
      • Women's health fact check
  • AYUSH
    • Ayurveda
    • Homeopathy
    • Siddha
    • Unani
    • Yoga
  • State News
      • Andaman and Nicobar Islands
      • Andhra Pradesh
      • Arunachal Pradesh
      • Assam
      • Bihar
      • Chandigarh
      • Chattisgarh
      • Dadra and Nagar Haveli
      • Daman and Diu
      • Delhi
      • Goa
      • Gujarat
      • Haryana
      • Himachal Pradesh
      • Jammu & Kashmir
      • Jharkhand
      • Karnataka
      • Kerala
      • Ladakh
      • Lakshadweep
      • Madhya Pradesh
      • Maharashtra
      • Manipur
      • Meghalaya
      • Mizoram
      • Nagaland
      • Odisha
      • Puducherry
      • Punjab
      • Rajasthan
      • Sikkim
      • Tamil Nadu
      • Telangana
      • Tripura
      • Uttar Pradesh
      • Uttrakhand
      • West Bengal
  • Medical Education
      • Ayush Education News
      • Dentistry Education News
      • Medical Admission News
      • Medical Colleges News
      • Medical Courses News
      • Medical Universities News
      • Nursing education News
      • Paramedical Education News
      • Study Abroad
  • Industry
      • Health Investment News
      • Health Startup News
      • Medical Devices News
      • Pharma News
      • Pharmacy Education News
      • Industry Perspective
  • MDTV
      • Health Dialogues MDTV
      • Health News today MDTV
      • Latest Videos MDTV
      • Latest Webinars MDTV
      • MD shorts MDTV
      • Medical News Today MDTV
      • Medico Legal Update MDTV
      • Top Videos MDTV
      • Health Perspectives MDTV
      • Journal Club MDTV
      • Medical Dialogues Show
This site is intended for healthcare professionals only
LoginRegister
Medical Dialogues
LoginRegister
  • Home
  • Medical news & Guidelines
    • Anesthesiology
    • Cardiology and CTVS
    • Critical Care
    • Dentistry
    • Dermatology
    • Diabetes and Endocrinology
    • ENT
    • Gastroenterology
    • Medicine
    • Nephrology
    • Neurology
    • Obstretics-Gynaecology
    • Oncology
    • Ophthalmology
    • Orthopaedics
    • Pediatrics-Neonatology
    • Psychiatry
    • Pulmonology
    • Radiology
    • Surgery
    • Urology
    • Laboratory Medicine
    • Diet
    • Nursing
    • Paramedical
    • Physiotherapy
  • Health news
    • Doctor News
    • Government Policies
    • Hospital & Diagnostics
    • International Health News
    • Medical Organization News
    • Medico Legal News
    • NBE News
    • NMC News
  • Fact Check
    • Bone Health Fact Check
    • Brain Health Fact Check
    • Cancer Related Fact Check
    • Child Care Fact Check
    • Dental and oral health fact check
    • Diabetes and metabolic health fact check
    • Diet and Nutrition Fact Check
    • Eye and ENT Care Fact Check
    • Fitness fact check
    • Gut health fact check
    • Heart health fact check
    • Kidney health fact check
    • Medical education fact check
    • Men's health fact check
    • Respiratory fact check
    • Skin and hair care fact check
    • Vaccine and Immunization fact check
    • Women's health fact check
  • AYUSH
    • Ayurveda
      • Ayurveda Giuidelines
      • Ayurveda News
    • Homeopathy
      • Homeopathy Guidelines
      • Homeopathy News
    • Siddha
      • Siddha Guidelines
      • Siddha News
    • Unani
      • Unani Guidelines
      • Unani News
    • Yoga
      • Yoga Guidelines
      • Yoga News
  • State News
    • Andaman and Nicobar Islands
    • Andhra Pradesh
    • Arunachal Pradesh
    • Assam
    • Bihar
    • Chandigarh
    • Chattisgarh
    • Dadra and Nagar Haveli
    • Daman and Diu
    • Delhi
    • Goa
    • Gujarat
    • Haryana
    • Himachal Pradesh
    • Jammu & Kashmir
    • Jharkhand
    • Karnataka
    • Kerala
    • Ladakh
    • Lakshadweep
    • Madhya Pradesh
    • Maharashtra
    • Manipur
    • Meghalaya
    • Mizoram
    • Nagaland
    • Odisha
    • Puducherry
    • Punjab
    • Rajasthan
    • Sikkim
    • Tamil Nadu
    • Telangana
    • Tripura
    • Uttar Pradesh
    • Uttrakhand
    • West Bengal
  • Medical Education
    • Ayush Education News
    • Dentistry Education News
    • Medical Admission News
    • Medical Colleges News
    • Medical Courses News
    • Medical Universities News
    • Nursing education News
    • Paramedical Education News
    • Study Abroad
  • Industry
    • Health Investment News
    • Health Startup News
    • Medical Devices News
    • Pharma News
      • CDSCO (Central Drugs Standard Control Organisation) News
    • Pharmacy Education News
    • Industry Perspective
  • Home
  • Ophthalmology
  • Ophthalmology News
  • Lotilaner Ophthalmic...

Lotilaner Ophthalmic Solution Promising Treatment for Demodex Blepharitis: Study

Written By : Dr Riya Dave |Medically Reviewed By : Dr. Kamal Kant Kohli Published On 2024-04-02T21:15:37+05:30  |  Updated On 3 April 2024 1:32 PM IST
Lotilaner Ophthalmic Solution Promising Treatment for Demodex Blepharitis: Study
  • facebook
  • twitter
  • linkedin
  • whatsapp
  • Telegram
  • Email

Demodex blepharitis, caused by an infestation of Demodex mites, poses a significant burden on affected individuals, impacting their quality of life. Traditional management options have been associated with adverse effects, prompting the search for novel therapeutic alternatives. A recent systematic review and meta-analysis assessed the safety and efficacy of lotilaner ophthalmic solution (0.25%) as a treatment for Demodex blepharitis. The study was published in the American Journal Of Ophthalmology. The study was conducted by Talha M. and colleagues.

Demodex blepharitis affects millions of individuals worldwide, leading to various ocular manifestations. Prior management strategies, including topical tea tree oil and antibiotics, were associated with adverse effects. Lotilaner, an antiparasitic compound, offers a targeted approach for Demodex eradication.

The systematic review included data from four randomized controlled trials and two single-arm studies, comprising a total of 328 neonates. Studies were selected based on eligibility criteria, including treatment with lotilaner ophthalmic solution and assessment of Demodex mite eradication and collarette score.

The key findings of the study were:

• Effectiveness of Lotilaner:

Lotilaner ophthalmic solution demonstrated efficacy in eradicating Demodex mites compared to the control group (RR, 3.55; 95% CI, 2.87 - 4.40; P < .00001).

The intervention cohort showed a significantly improved clinically meaningful collarette score compared to the control cohort (RR, 3.15; 95% CI, 2.56 - 3.89; P < .00001).

• Safety Profile:

Rare adverse effects, including mild burning, redness, and blurriness, were reported with lotilaner treatment, reaffirming its favourable safety profile.

Lotilaner ophthalmic solution (0.25%) emerges as a promising treatment option for Demodex blepharitis, offering efficacy in mite eradication and improvement in collarette scores. The findings underscore its potential as a specific and well-tolerated therapy, enhancing the management of this common ocular condition.

The approval of lotilaner by the FDA signifies a significant advancement in the management of Demodex blepharitis. Its targeted mechanism of action and favourable safety profile position it as a valuable addition to existing treatment strategies, benefiting patients and healthcare providers alike.

Reference:

Talha M, Haris Ali M, Fatima E, Nadeem A, Ahmed A, Nashwan AJ. Efficacy and Safety of Lotilaner Ophthalmic Solution (0.25%) for the Treatment of Demodex Blepharitis: A GRADE Assessed Systematic Review and Meta-Analysis of Observational & Experimental Studies. Am J Ophthalmol. Published online March 19, 2024. doi:10.1016/j.ajo.2024.03.019

American Journal Of OphthalmologyLotilanerDemodex blepharitissystematic reviewmeta-analysissafetyefficacy
Source : American Journal Of Ophthalmology
Dr Riya Dave
Dr Riya Dave

    Dr Riya Dave has completed dentistry from Gujarat University in 2022. She is a dentist and accomplished medical and scientific writer known for her commitment to bridging the gap between clinical expertise and accessible healthcare information. She has been actively involved in writing blogs related to health and wellness.

    Dr. Kamal Kant Kohli
    Dr. Kamal Kant Kohli

    Dr Kamal Kant Kohli-MBBS, DTCD- a chest specialist with more than 30 years of practice and a flair for writing clinical articles, Dr Kamal Kant Kohli joined Medical Dialogues as a Chief Editor of Medical News. Besides writing articles, as an editor, he proofreads and verifies all the medical content published on Medical Dialogues including those coming from journals, studies,medical conferences,guidelines etc. Email: drkohli@medicaldialogues.in. Contact no. 011-43720751

    Show Full Article
    Next Story

    Editorial

    Penicillin-Binding Protein 3 Inserts in E.coli:A Growing Burden of Underreported Threat

    Penicillin-Binding Protein 3 Inserts in E.coli:A Growing Burden of Underreported Threat

    Management of Hypertension: How Innovative Packaging Can Improve Patient Outcomes?

    Management of Hypertension: How Innovative Packaging Can Improve Patient Outcomes?

    Uncontrolled T2D in India: Valuable Consideration for Dapagliflozin Sitagliptin Combination

    Uncontrolled T2D in India: Valuable Consideration for Dapagliflozin Sitagliptin Combination

    JAPI Releases Dedicated Supplement Addressing Clinical Needs for Adult Vaccination in India

    JAPI Releases Dedicated Supplement Addressing Clinical Needs for Adult Vaccination in India

    Cuticapil Stem Hair Serum as Add-On to Minoxidil Shows Superior Hair Growth in Androgenetic Alopecia : Indian Real World Data

    Cuticapil Stem Hair Serum as Add-On to Minoxidil Shows Superior Hair Growth in Androgenetic Alopecia...

    View All

    Journal Club Today

    Sausages, Sodas, and Cancer: Ultra-Processed Foods May Be Linked to Higher Lung Cancer Risk

    Sausages, Sodas, and Cancer: Ultra-Processed Foods May Be Linked to Higher Lung Cancer Risk

    View All

    Health News Today

    Health Bulletin 01/August/ 2025

    Health Bulletin 01/August/ 2025

    View All
    © 2022 All Rights Reserved.
    Powered By: Hocalwire
    X
    We use cookies for analytics, advertising and to improve our site. You agree to our use of cookies by continuing to use our site. To know more, see our Cookie Policy and Cookie Settings.Ok